DPCstruct | MC20
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 269 ± 32 aa |
| Standard deviation of domain lengths | 31.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I2SNP8 | 2-249 | QRHAKVAEAEAKEKEAEAALTQAKADNKMTQQEHDDLAAKNDAVTAAKADAAKAVEGLPAGDAKDGLNGRLAKVDGIDVPAVDENGN… |
| A0A0A2YJF0 | 9-310 | SIARWYCISRRRWKQWRQGIIPYWGGVESTQITAAKDAVKAAEEAYQKAKNLLDKAKEDNQITAEEELALKEANKAIEDAKTKAEEA… |
| A0A1B3JFD3 | 150-410 | None |
| A0A8A6QPV1 | 647-903 | None |
| A0A376Y320 | 267-502 | None |
| A0A833PCA5 | 2-236 | None |
| A0A376ZSY6 | 562-851 | None |
| A0A8B5JM22 | 290-548 | None |
| A0A8B4R870 | 1-309 | None |
| A0A240BSQ1 | 625-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.