DPCstruct | MC2
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 368 ± 53 aa |
| Standard deviation of domain lengths | 52.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5HAR7 | 518-906 | GLSKQEALRSEVFGLIARVRQMGVPADGFVYYERGWYTGTEFTYAKLDHKARKGAGLVAKIDTKSASEGYRIYREIADDGTLTPEFK… |
| A0A2A2QTX3 | 20-353 | NTPPPEFVERAGQWMISTDPSKRQAAYRSWLQLGPGTMEAYEKALRSTLKYHDQKIDKLARGEGASNPYEAHDAALSELETERERVM… |
| A0A2D6PRF0 | 344-790 | None |
| A0A0S8ES32 | 36-368 | None |
| A0A7Y5LZT4 | 111-484 | None |
| A0A6N6JP41 | 42-395 | None |
| A0A7C7YUC5 | 286-739 | None |
| A0A660VCT6 | 42-480 | None |
| A0A660VZ25 | 730-1168 | None |
| A0A518D440 | 136-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.