DPCstruct | MC19995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524EK44 | 1-95 | MDISDGQNLMREIYLERDNTRGVNGTLIRTFQELAELSEAVSKNQTMKDIQDELADVFAWLLSLANLLKIDMTRAFLMKYGKGCPKC… |
| A0A517N0V5 | 8-106 | ISLRDFQQLIRGMYHEKDVARGIDGTFMWLMEEIGELASALREGTPEAGPSENLAAEFADVLAWLTTIANVAEVDLSAAVTDKYGKG… |
| O73989 | 2-72 | None |
| A0A2H0WSA9 | 41-142 | None |
| M1JAB0 | 1-80 | None |
| A0A2E7KHT8 | 2-83 | None |
| A0A538B1V5 | 1-93 | None |
| A0A7C0XRD8 | 1-69 | None |
| A0A1Q9PD14 | 4-85 | None |
| A0A7Z9PVH9 | 6-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.