DPCstruct | MC19994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517MS18 | 1-76 | MVYDTAHRLGAYLELEPEYVCLHAGVRVGATAISFKPSTKWIEPTSLPKPFQKLFAGEVGDCLCICKDALHAMANK |
| A0A517T1Y6 | 156-229 | IGELMVYDTAHRLGAYLQLKPEYVYLHAGVRVGATALGYKPSTKWIEPTSLPKPFQKLTAGEMEDCLCIYKHAL |
| D4WIG3 | 196-273 | None |
| A0A1B9AGD4 | 23-89 | None |
| A0A4R6T8W6 | 136-222 | None |
| A0A1T4NJ08 | 104-182 | None |
| A0A845YVC3 | 7-70 | None |
| A0A2V9HR89 | 28-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.