DPCstruct | MC19987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1AQY1 | 55-205 | AGSPVPQGSGTIPASAYPAPPNLHWGLVLLFGIVTCGVFMWVWMFIESSYVSRIDRENKSTMLYAIGLSCFLIFGFFHRLEPLSGAA… |
| A0A2T5MKK7 | 3-150 | QEDLIRGLRVHSTTLLFFLSGITFGAYIAHYCAKQSKAINQRLGQEERIPAILNATLFLLSYSSITLSIGHFIFQENAAIENTGGVV… |
| I3ZF29 | 1-154 | None |
| A0A3L2VXA2 | 13-161 | None |
| A0A2D8RIL6 | 49-220 | None |
| K9NGG1 | 8-155 | None |
| A0A0C5VUQ6 | 1-163 | None |
| A0A1V3IPK6 | 1-167 | None |
| A0A2N1W7D0 | 33-169 | None |
| A0A317C624 | 3-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.