DPCstruct | MC19986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3VVG6 | 1-80 | MESIFHEKQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYRRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNL |
| A9S1Y5 | 70-146 | NVDADGNFSIQVLNRALQIWNLQCVPLEAPEAADARTDPQKQSAFICHLQAHWFCIRRVGERWYNFNSLYPAPEYLS |
| A0A498IES7 | 284-359 | None |
| J5QMJ9 | 52-141 | None |
| A0A0B7NFI1 | 447-530 | None |
| A8JFQ2 | 57-136 | None |
| A0A2K5QS88 | 3-65 | None |
| A0A673HXI9 | 1-80 | None |
| A0A6J1F1U3 | 58-135 | None |
| A0A5N5T679 | 19-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.