DPCstruct | MC19980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 240 ± 31 aa |
| Standard deviation of domain lengths | 31.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 91.49 |
| Assigned Pfam label(s) | CL0195- PF15447- CL0656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024VTY5 | 5-196 | PSEEKTVNEIAEAIQKGVAKSIIPPSILTANASRGEYRKGVNKTDFNNLCSIMDRHSNDRREDGSGNDKYGGPCTGKGTGENDQRFI… |
| A0A024WZ21 | 5-240 | KVAKEIQGDAHERVKTINGLIADASQGHYSRGGDTQDFKDICKITENHTNAEDSYHYKYDGPCGGKDGGGEMFKLENVWKSGAEVSE… |
| A0A0L7KJM2 | 1-219 | None |
| A0A024WYH1 | 1-246 | None |
| A0A024WYM4 | 1-191 | None |
| A0A024X0W2 | 1-260 | None |
| A0A2P9A842 | 15-248 | None |
| A0A024XF42 | 1-261 | None |
| A0A060RQN5 | 12-253 | None |
| W7JKP4 | 1-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.