DPCstruct | MC1998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 146 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A3T2Z1 | 1-129 | MYAAAIEALPDPSDPEFPDRAGVILAGLRKLQDSLTDAAARSRATPSVIVALSGVRNQYDELMATAANGPGATHGQRLYTARGRAKL… |
| X8BG20 | 9-164 | GEAQVIVDVAEAAMHMYRAAIDSLPFPEDKKFQKRADVVLSGLRKLRAALTDAASHSRSTSAVIVALSEVRRRYDDLMARAAAAPGA… |
| A0A0J6WL82 | 213-351 | None |
| A0A0J6WBT0 | 1-158 | None |
| A0A5A4WIQ5 | 180-325 | None |
| A0A655IW98 | 29-182 | None |
| A0A1A3PYV4 | 17-164 | None |
| A0A5A7X4L3 | 320-470 | None |
| A0A1Q4TWH4 | 3-135 | None |
| A0A0M2JUI5 | 108-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.