DPCstruct | MC19978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4U9F5 | 2-127 | PAATISADGALSVDGKPVDLNEAQRQAMRSYYAQVQGVAKKGIDIGTQGAAFGAHAAGEAIKGVLSGNSDQIGDKIEAEADTFKNKA… |
| A0A1H0ZMJ5 | 15-172 | AVLVAGCTPGTHVSTDKGNVSSNGKVITLRANGQPDAKISADGELTIDGKAVAMNDTQRALLQTYLKEMNAMTADGIAIGKQGAALA… |
| A0A6H9KSY0 | 13-154 | None |
| A0A496PTM5 | 55-225 | None |
| A0A1M3QJ00 | 26-172 | None |
| A0A3R8NNX8 | 41-214 | None |
| A0A522RRJ8 | 326-480 | None |
| A0A7C2K5W9 | 15-150 | None |
| A0A7V0XHG2 | 9-183 | None |
| A0A2K1PZF3 | 69-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.