DPCstruct | MC19971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4Q785 | 2-91 | THLRVGWHHDVSGDPVLLYSELDAARHEIRKVEVYRDGRGDRAGPGEATGSTRLGSEPVPESAEIAAQPEFTPEPISAEVFETAWRA… |
| A0A1C3EKB3 | 6-119 | LMRYFKQRGCCLRRDSLAASWGECIRYVEIGDDRYAVRQVEVYNSGRVLRYERSHWCDRFGQLFGCLFSQKHKAIDGRLTAEVIDAK… |
| A0A075V1T4 | 87-175 | None |
| A0A7W3QKG4 | 2-86 | None |
| A0A429ERE1 | 186-277 | None |
| A0A429AXW1 | 10-97 | None |
| Q2F9T9 | 1-89 | None |
| A4YYE6 | 144-231 | None |
| A0A6H1KX39 | 221-313 | None |
| A0A3E0PW75 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.