DPCstruct | MC19970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | CL0603- CL0118- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446N6W1 | 2-83 | HNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYVSLRDKGKVIDVLRNWP |
| A0A1C3EHD1 | 2-120 | SDPAFNKGTAFSIQERDRFGLHGLLPPHIESLDEQVQRVYEAYQRKDDDLERHIYLRALQDTNEVLFYRLLLEHIEEMLPIVYTPVV… |
| A0A7H4SJG6 | 9-144 | None |
| A0A817PZA6 | 1-107 | None |
| A0A817QS50 | 368-475 | None |
| A0A6D2HEF4 | 435-578 | None |
| A0A6D2JFL9 | 1-119 | None |
| A0A5N3WKJ4 | 27-138 | None |
| A0A453E6P2 | 76-194 | None |
| B5IJQ0 | 289-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.