DPCstruct | MC1997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9SUU6 | 91-178 | ALFGRDTLTASWKAALLGPETMRGTLAELPRWQGKEVNDWRDEQPGRMLHEAHDNPLAALQFNPQSRYYGSITTSAFYPVVVSELWHW |
| K0DTP9 | 1-77 | MALFGRDSLIASLQTALVHPGFARAVLDVLGSVQATERDDYRDAEPGKIMHELRRGELAKLKLIPHTPYYGTADATP |
| A0A537Y5C6 | 408-499 | None |
| I0LCU0 | 274-361 | None |
| A0A7W4M5K1 | 312-399 | None |
| A0A0F8M2C1 | 220-307 | None |
| A0A2C9T1B9 | 38-124 | None |
| A0A0K8Q4Z4 | 10-98 | None |
| V7F7X8 | 35-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.