DPCstruct | MC19965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 229 ± 53 aa |
| Standard deviation of domain lengths | 53.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF10173- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5XM48 | 2-253 | RLFVLPVSTKRSLLYAQRFNATTTATNASLSDRLTRRANAMWASWEAKDGGWQKHLVLYGNKLLRQIPMEEWSLKSVPPLSSQLQKL… |
| A0A0U2ZU66 | 2-157 | KDRGLCWIAEKIAEQRLLWRLRNETRLILHHPDDMTVDEANGIARAELQREADRHMKWIVIDGLLFVGSGLFFLVPGPNLIAYYFGF… |
| A0A1V2LP21 | 33-218 | None |
| A7EWT3 | 42-266 | None |
| A0A0G2IGQ2 | 14-322 | None |
| A0A178BJB1 | 50-450 | None |
| B8NZV0 | 7-247 | None |
| A4RZS1 | 4-240 | None |
| A0A7C9DS14 | 1-181 | None |
| A0A287TLK6 | 10-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.