DPCstruct | MC19964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 296 ± 60 aa |
| Standard deviation of domain lengths | 60.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5G9B2 | 37-295 | AGTPTGTTTHTTSTSNFLTASSAELPKYTAPPSVPSPALPVPTPFPAPFDISLSFNVTTPSCINFFNTFIQNVTFRACRPFGMLMSS… |
| A0A2C5X3I0 | 11-340 | APLSLSQTLWSAAFVALVSQSTLASPVTASGSDLTVSSSTVELPPFITPAAFDSHDYGEDTQLAVDTMRPIRIDGQWKLVDDVEWEL… |
| A0A218YUA9 | 248-617 | None |
| A0A0F7SNT3 | 25-315 | None |
| A0A4Z1J197 | 152-397 | None |
| M9LZS5 | 45-482 | None |
| R1ECL9 | 1-155 | None |
| A0A1C7LS10 | 142-487 | None |
| C9SDX5 | 3-255 | None |
| A0A1E3J9J8 | 6-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.