DPCstruct | MC19962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 189 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521I0K4 | 1-220 | MANESNRQDNLSTLIAVLIALLSLAGAIVAWRVAGAASAAGDADAKGLLAAVDAEDAKTDAKTTVLGHLLVYARAVQNEVLKSEFDA… |
| A0A7K1TW42 | 2-191 | IAVFVLSITAVVTAWCGFEASKWGGDMSISFSQASSARVQATAAEGQARDARQYDLTIWTQYVLAEAEGNTQLVSYIEQRFTPEFRT… |
| A0A6B3UME4 | 1-214 | None |
| A0A3N5LHM1 | 22-234 | None |
| A0A2Z3H795 | 11-211 | None |
| A0A5C8HPQ2 | 48-257 | None |
| A0A7V9B709 | 14-219 | None |
| A0A1Q7BSS2 | 17-188 | None |
| A0A7L5Y1W3 | 2-177 | None |
| A0A2U1X1M8 | 2-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.