DPCstruct | MC19961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6FWB0 | 22-90 | CDIPADPELVAEGWQFRCNTDHSRLNDVVDTYKELGFEIHLEPVNLTGLSSDCGGCASLLQTFSAVYTK |
| Q5P0N5 | 31-101 | EDRLLRQGWKRLTTIGEPRLSEIAEAYRGMGFEVHVETYKSEGDGCNTCLDADQEMGKIIGTVYTRRAAVP |
| A0A7C7ZVT5 | 10-85 | None |
| A0A7Y8IQK5 | 119-190 | None |
| A0A522FN29 | 1-69 | None |
| A0A3A4Z9P9 | 9-90 | None |
| A0A7C4CU33 | 5-70 | None |
| A0A3N0ZRU1 | 4-66 | None |
| A0A151EP56 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.