DPCstruct | MC1996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18072- PF00586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5K0W8 | 1-113 | MTEWQKMGLTDEEYQLIIDRLGREPNYTELGMISVMWSEHCSYKNSRAILKTLPTSGPQVLQGPGENAGIAHIGDGIGVAFKIESHN… |
| X7ZVY8 | 25-158 | FRELGLKDDEYQRIRDILGRRPTDVELAMYSVMWSEHCSYKSSKVHLRYFGETTTDEMRAGLLAGIGENAGVVDIGDGWAVTFKVES… |
| A0A6C0L1C1 | 196-314 | None |
| A0A7G3D7F3 | 6-125 | None |
| A0A538B283 | 95-227 | None |
| K6QFC0 | 41-158 | None |
| A0A7K0BUN8 | 223-341 | None |
| A0A0K2QX73 | 14-152 | None |
| S4XJT0 | 20-140 | None |
| A0A380EI80 | 18-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.