DPCstruct | MC19959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5LNX8 | 2-124 | QQNTEMMQSQTRNSIVANQLSVYDKMVENPELFDIADKRSANLDVTNAEWQQLHIFILSQLRIWENEFYQYQIGLYAAEEFEARKIW… |
| A0A497CBU7 | 5-159 | NWIGLAGLIITILGFAITIYTLSQMTKQTGEMIRQTEEMSSQTKQLRKSVRLETYQRVYEKMIDIDLFFVENAELKSYFYSSKTVDD… |
| A0A4Y9END5 | 1-160 | None |
| A0A1B6Z637 | 1-163 | None |
| A0A6N7A6C2 | 1-172 | None |
| A0A367Q6E4 | 87-251 | None |
| A0A498AQJ3 | 4-141 | None |
| A0A2E8MY93 | 2-152 | None |
| A0A7Y8SQ72 | 1-157 | None |
| A0A154R5T0 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.