DPCstruct | MC1995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 60.94 |
| Pfam Score | 81.94 |
| Assigned Pfam label(s) | PF14711- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377D117 | 191-284 | RYLGVLLYDADAIERAASTENEKDLYQRQLEVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVW… |
| X7Z478 | 2-88 | LYDADRVLDAAATPDLQDLYEAQLGVFLDPNDPHVVAEAARQGIPHDWIQAAQRSPVYELAVRHKVALPLHPEYRTLPMVWYIPPLS |
| A0A447U377 | 60-146 | None |
| A0A0C2MKV8 | 250-344 | None |
| F9EIH6 | 269-360 | None |
| A0A377E5C6 | 16-104 | None |
| A0A7Y5RTR5 | 54-146 | None |
| A0A376TGF4 | 53-145 | None |
| A0A377BGU8 | 52-146 | None |
| A0A0H2KH28 | 46-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.