DPCstruct | MC19949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7QV90 | 1-70 | MLTGRQIRMARAALDWSLRVTAERAGVHENTVRRIERGENTNPGTLFLLKSTFEAAGVTFLDNGGVVPPE |
| A0A564G469 | 232-303 | AILTPEPCKLARAGLGISDLAERAQVSTNTVSRFEAGEELKSRTVAALQAALEAAGVIVIEQNGEGPGVRLR |
| A0A7W5YXS0 | 2-72 | None |
| A0A845UXV7 | 1-77 | None |
| A0A7C1TTE2 | 2-75 | None |
| A0A6N6VNV9 | 2-77 | None |
| A0A7R7BS64 | 11-94 | None |
| A0A4Q3MJY5 | 1-77 | None |
| A0A127CIN1 | 42-128 | None |
| A0A849E8W8 | 5-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.