DPCstruct | MC19948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 3 aa |
| Standard deviation of domain lengths | 3.14 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9CSI8 | 28-143 | LKARFGGKIEIDWDIPEAHRDNLPERIDAVLPTATFPPFPFGTDFTRIELQLLRVMQYLADHAARPAQLAALVARGLRGGQPDEAEF… |
| A0A7X8U642 | 389-510 | AKAKKYGKIPMDYEIPEEYRHNTPEKLKALLAPYHAQGYFPPFPFGTDLTKDDIELAGSLKALKSLAGGYPLQVAKGMLLELLRPIP… |
| A0A1P8YFS2 | 27-144 | None |
| A0A0F7YD90 | 502-617 | None |
| A0A560R3T3 | 9-119 | None |
| A0A7X9GMN8 | 82-203 | None |
| A0A3N5FGC9 | 142-260 | None |
| A0A2G2HX31 | 237-356 | None |
| A0A7S7Q8V5 | 392-510 | None |
| A0A1I4J321 | 301-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.