DPCstruct | MC19943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 389 ± 56 aa |
| Standard deviation of domain lengths | 56.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.70 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0123- PF13919 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068UEU7 | 8-401 | GRVSHDMLEQEDLDAANVLMDLAKDTGSVDRLLAKAPTNQNRNPKKISASAFDSEFSIIHFLSAVRLVLITPVAEDFTVTHSRRVES… |
| A0A401NHR4 | 4-294 | FTKTLDATKPTAVPGITASFFSLLQEILLAEGEASVAGIEEKVLEWQISAPSTLNSWFSDASNWSELVHSALRFLSGEGGMSALPTN… |
| A0A443QR68 | 395-717 | None |
| A0A0S7L8D6 | 243-681 | None |
| A0A0P0WH74 | 706-1100 | None |
| A0A654HX68 | 33-496 | None |
| A0A5K3FMX5 | 37-444 | None |
| W4GGI4 | 138-514 | None |
| R1F2F1 | 104-541 | None |
| A0A200QHQ3 | 359-834 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.