DPCstruct | MC19941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9IJJ6 | 133-254 | MDRNGQQMMQKAIQLAEAVFEYGKGEHKKVFDTLGPDFDALGYKMIGASDEQVDVFNEVWYTVLINAGETSKAIEVLGKQIRKREGA… |
| A0A068TVK4 | 4-100 | YIRKARSCERWRESQCISGRAIGASDEQLDVFNEIWIILLINGGETTRATEAIEKQLKKREGAPFLWRLLEKCYHTLGRPEAASVGE… |
| A0A078I736 | 100-212 | None |
| A0A2P2MLA0 | 43-163 | None |
| A0A0D3CCZ2 | 1-134 | None |
| A0A816KUM7 | 114-214 | None |
| A0A287N0B0 | 9-123 | None |
| A0A1D1XK03 | 26-139 | None |
| A0A078J6P6 | 97-216 | None |
| A0A7J6I1X9 | 265-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.