DPCstruct | MC19939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6671 |
|---|---|
| Mean domain length (aa) | 157 ± 45 aa |
| Standard deviation of domain lengths | 44.96 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.19 |
| Pfam Score | 55.01 |
| Assigned Pfam label(s) | CL0681- PF16963- PF05231- PF06580- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5YEH8 | 5-124 | EQLELLHRRMVEEVQDYAIILLDLDGTILSWNKGAQQIKGYTPDEILGQNFRLFYLPRHREEGLPEALLAQATKEGRARHIGIRLRK… |
| A0A291LVK2 | 8-137 | DGVQMTIDRLPVALTVADPSQPDCPLVAVNGRFQEMTGYAPADVIGRNCRFLQDGCDGSDNEAAREAIRTALSRARGVEVVLRNRTR… |
| A0A654HJM4 | 4-150 | None |
| A0A1I4QPH4 | 325-546 | None |
| F4PPD4 | 43-272 | None |
| A0A6P1TL32 | 209-376 | None |
| A0A2U8GGE9 | 166-381 | None |
| H0UQR1 | 49-301 | None |
| A0A4Q8U0A6 | 19-176 | None |
| A0A401FIS4 | 10-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.