DPCstruct | MC19935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M4RMS2 | 1-79 | MTQYTPLSQSPNTVLFINPEAPLPDLHHCAVQRLRAVKDLMNSLSDAKETDTARLASAAYLLLQDSCDVLEVMEVRLDK |
| A0A7Y8BM58 | 1-91 | MTTYHPLTTSPAGTPVLLIDTQAPLRLLHETAYARIRAGTAQLETLTSVTVRNIDDADLYRLTNGAYLLLQDGLDILDRIQFRLPLE… |
| A0A3M4FZ25 | 134-218 | None |
| A0A1H7Y9K9 | 1-103 | None |
| A0A1H7HW23 | 6-91 | None |
| A0A3G7JVC7 | 183-266 | None |
| A0A1H4R3G5 | 50-143 | None |
| A0A1H1NK62 | 1-87 | None |
| K9NCB3 | 10-90 | None |
| A0A5E7PB92 | 7-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.