DPCstruct | MC19934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0LC41 | 33-162 | EKMFTTEQIKEKLSKVETGADFPALATGLKNIGVTYYETKMEDGSSIFHGKNGYELPTVPNYEPILIADTVNLEQLKIDIANHQQGK… |
| A0A345P928 | 82-208 | FTIDHISQIHASVKLGSNFPQYVQDLKALGMAYYDVFACDGHSEYYSTSRERLESPKKYPTIGIASKGDAHALRRTISLHQLGSINF… |
| E1JBX7 | 38-172 | None |
| D7XQD9 | 38-172 | None |
| A0A1H1YV25 | 7-132 | None |
| A0A254QJY0 | 3-115 | None |
| A0A194X9I5 | 129-280 | None |
| A0A840KBN5 | 20-137 | None |
| A0A1G8ZHC0 | 1-97 | None |
| A0A4Z1NM56 | 9-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.