DPCstruct | MC19933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200QQ48 | 3-106 | RILEGRTRIEELIFALSFITAMVLVQLPYEEINGNPVPTIIFHDQPSVFHAFVLAVNFAFTGAVITLCIREEYPKIARNCRRIAIVF… |
| A0A067FSC0 | 3-106 | KKLYKSTQLEELILGFSIATTLVLVKLPYEKIDGNPVPTVIFKNRPGLFHAFILALNFSFFGSVLTISLRGKYARIARYPLILAAVS… |
| A0A200QQ03 | 34-135 | None |
| A0A822XJU2 | 65-170 | None |
| A0A3Q7E9W4 | 94-189 | None |
| A0A059D6V4 | 4-111 | None |
| A0A7N2MRW5 | 1-145 | None |
| A0A2P2QR84 | 47-159 | None |
| W9RAS0 | 13-124 | None |
| A0A067L742 | 17-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.