DPCstruct | MC19932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 284 ± 24 aa |
| Standard deviation of domain lengths | 24.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9CRH4 | 36-316 | TGAGRAACWIIFDIYVENAIDGRHLSGISAIEVLKEMTKTLQVLNEASWQETFKALWISALRLVQRAREPLEGPIPHLDARLCMLLA… |
| A0A067FN39 | 1-303 | MSLAGQCNGTSRSALWLPIDLFLEDAMDGTQVAATSAVEILTGLVKALQVVNGTTWHDTFLGLWIAALRLLQRERDPSEGPVPRIDS… |
| A0A7C9A4J5 | 91-365 | None |
| A0A453BKX1 | 27-292 | None |
| A0A178VLL7 | 287-556 | None |
| A0A7J7H5Y6 | 105-403 | None |
| A0A1U8N4N0 | 154-445 | None |
| A0A0D3BNJ9 | 87-392 | None |
| A0A835R5G6 | 34-340 | None |
| A0A2I0LCW6 | 9-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.