DPCstruct | MC19931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 49 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.90 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF04419- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3EFN3 | 338-380 | ALTIQCQVCKATFLQTTKAPALLEHASNKHNKGLADCFPGAGQ |
| A0A2S6BQE2 | 20-68 | NKGSQLKTNAAAKTIKCKVCFADFQSTTKQPALTEHASNKHNKKYEDCF |
| A0A4S4M5W0 | 429-471 | None |
| J4WLP9 | 1-52 | None |
| A0A5J4WZK4 | 166-217 | None |
| A0A319A3J8 | 1-53 | None |
| A0A1E5VGA2 | 197-251 | None |
| A0A5B0REV7 | 105-150 | None |
| A0A0L6UNQ6 | 125-175 | None |
| A0A2T0AEI3 | 102-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.