DPCstruct | MC1993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 181 ± 13 aa |
| Standard deviation of domain lengths | 12.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5C5M0 | 33-210 | KVIVVTGFAEVGPWGSSRTRWEMEARGQFTIEGCIEMAWMMGYIKHFDGRLKNGNLYVGWVDSKSGDPVDDKDVRGKYEKEILEHSG… |
| X7YV53 | 1-187 | MVIVGGAELGPYGSSRTRFEMEVDNELSAAGVLELAWTTGLIRWHDDPQPGWYDTESGELVDESELVERYHDTVVERIGIREWVDDG… |
| Q00681 | 786-955 | None |
| U0E4Y6 | 484-667 | None |
| A0A180FZF3 | 141-323 | None |
| A0A4Q7K9M7 | 1-197 | None |
| A0A6G0X2R2 | 794-980 | None |
| H0EC83 | 397-574 | None |
| Q5B7V0 | 909-1099 | None |
| A0A3D0ZSM6 | 3-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.