DPCstruct | MC19925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 245 ± 23 aa |
| Standard deviation of domain lengths | 22.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2YNT3 | 72-295 | NSPNDNYHRHQFNTPSLSYATTHASPESISTPAPTPQKLAAQGIKNILDGKIEIIESNTPSKAIVVAQSSGPKCVPKPSPVPARFMG… |
| A0A7S3QAM9 | 1-264 | NVHGHGHGHGHGHGHGKRASPRRHVHFTSTGGQSQGQGQSQSSQRDNNNNQDQEDESIPDFQSLVNFPYHVTRRSSSGKSLQARQCV… |
| A0A7S4A9C2 | 766-1008 | None |
| A0A7S0UIW8 | 368-614 | None |
| A0A7S4E5E9 | 1-217 | None |
| A0A7S1FPI9 | 286-504 | None |
| A0A7S2Q4B5 | 1-248 | None |
| A0A7S4W8N1 | 486-779 | None |
| K0TCZ4 | 1027-1279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.