DPCstruct | MC19924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3V759 | 46-156 | LNNRDYTYTAPNGKERTCQNIRWKEKRRRYLCSTQIEVRKNCPQTCGITCFDDPKFRLIKLSNRDRKPCSWLRGPSKESSKRVETYC… |
| A0A7S3QA89 | 130-300 | GSCINDASWRGKFNDLHTCDHVARDPTIRCSWESSDNVSANVACVAACDPNCATSPGPSSAPSTAPCSNVESFTFLVGKKNKEVGCS… |
| A0A7S3QEQ0 | 355-485 | None |
| A0A7S3V4J7 | 351-502 | None |
| A0A7S3V4L6 | 116-270 | None |
| A0A7S3V5G9 | 2-152 | None |
| A0A7S1D5I2 | 43-186 | None |
| F0XVU9 | 118-312 | None |
| F0Y330 | 874-1037 | None |
| A0A7S1BYA4 | 466-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.