DPCstruct | MC19923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7G3K8 | 2-167 | SPSADFTISDFPHKVLNPIATDTIAPSYASLLLAQRQLSTNASAIPSLNGGGAHGHMALTLTADAYAELSNIPFVIPVAPPADPEPG… |
| A0A7S3Q959 | 1-153 | MASSSSGGGIDYRSIYFAFPNLDPINGEPDADILIKLKNQLKANASSVPSNLGGGNHGHLGLVMSPQTYAMVSNFPFVQPVHPGALV… |
| A0A1E7EX85 | 765-926 | None |
| K0RGP5 | 11-162 | None |
| A0A1E7F1J5 | 225-382 | None |
| A0A1E7EYL3 | 8-165 | None |
| A0A7S2EN21 | 5-170 | None |
| B1PJ40 | 15-149 | None |
| A0A1E7FKF6 | 5-182 | None |
| A0A7S4K100 | 11-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.