DPCstruct | MC1992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 257 ± 32 aa |
| Standard deviation of domain lengths | 32.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9F8M9 | 99-299 | VLPSQEDWTNALHRAKAVFGIGASEHHLSSSAVKRVGDELVTKLRNVDRGATDLVGGLEAHGDVLGLGDVSPRLATGRRARDLIGAL… |
| X7YPH1 | 28-267 | IELRAEELPAQQAWDDARANASKLFGYTMPRTYLTGANVAEFAAQVRAKASEAVTELGHLIDQLQPAHSRLGSTPGADDRLTVAVAL… |
| A0A1D2IJH2 | 385-670 | None |
| A0A6P2B7V6 | 465-712 | None |
| A0A2A4ZVY0 | 159-404 | None |
| A0A535ELP7 | 727-1070 | None |
| A0A7K0P3X0 | 353-605 | None |
| A0A3B9QSF5 | 4-269 | None |
| A0A1Q2CWF1 | 283-532 | None |
| A0A4U1HMI9 | 6-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.