DPCstruct | MC19919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 257 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817GLS4 | 208-450 | AEESKNQDEQAKIETLHKKRNLLAAYCKLIVHNVLPIQAATNILKYYVKFSNDFGDIIKNTFTRARDISKIHTAKTMAYSLMAVYKD… |
| A0A834C756 | 3-253 | YMKYNNDFGDIIKEMLFRTRQTDKIGSARTLVLCLQQLFLRLKQEQERGDGAHPGVQTFTTIKELARRFALSFGDLVKFRECVVMIH… |
| A0A820WJS5 | 89-321 | None |
| A0A2D4F1C7 | 39-316 | None |
| A0A4C1TPA2 | 50-291 | None |
| A0A4W5MMD0 | 157-397 | None |
| A0A5E4AUX2 | 3-276 | None |
| G3I5G1 | 119-412 | None |
| A0A811Z8J8 | 164-472 | None |
| A0A0K8VCD5 | 413-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.