DPCstruct | MC19918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 181 ± 28 aa |
| Standard deviation of domain lengths | 27.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813K4W7 | 22-155 | DCPPLPGHREHSCTDIAWLLLLSLAMGGLCYPIWHAESNGDLTKFFRGFDYKGRMCGRDVPGSFEFWCQRPGYPPDSKHPICVAECP… |
| A0A834C3W3 | 4-167 | GEPRKYDPTFKGPIEKRGCTDIVCCILFIICVLAYIAVGILAWSQGDPRKAIYPTDSRGQFCGQAGTPLEKKPLVFYFNILKCASPM… |
| A0A3Q7SSH7 | 6-196 | None |
| A0A4Z2HVB1 | 34-222 | None |
| A0A1Q9CMW5 | 42-206 | None |
| A0A482V878 | 1-152 | None |
| A0A815HW76 | 2-181 | None |
| A0A7R9AMS7 | 89-338 | None |
| A0A6G0SDS1 | 405-608 | None |
| A0A6B0RYP7 | 84-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.