DPCstruct | MC19917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 340 ± 55 aa |
| Standard deviation of domain lengths | 54.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834C2N0 | 1-353 | MGFEPRGTYIGVRLSSLSKLQENTGPGKAVTAVPQQLSGRLEDVFSQSGNGSKRCSRGRFKRMLATDSSSDAFLCDAPGEKTFGPTC… |
| H3DIX4 | 2-391 | YSHVIVTYPSAVLLGCAVLLLGFSLAGIFLGPLPDFSNPLLGFEPRGTYIGVRQSRFFLLQENTGPGKTLSHLPQRLNHRSYPLSGT… |
| A0A7M7RB53 | 249-625 | None |
| W6UJI6 | 4-238 | None |
| A0A5S6QUD8 | 7-410 | None |
| A0A0N4XAY2 | 1-326 | None |
| A0A183CUZ2 | 3-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.