DPCstruct | MC19912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 251 ± 36 aa |
| Standard deviation of domain lengths | 36.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 88.51 |
| Assigned Pfam label(s) | CL0005- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CYC6 | 80-369 | CISLGATMDGFLLAALAAFMPKYMESQFGLTPGYAAILIGILIVPAGAGGSLLGGFIVKFYEFTRTQSIAMYIVCQLAILPLYLGFL… |
| A0A834BUQ0 | 21-297 | NLLMGMVNIPAVALGMFSGGVVMKRFKMGVMGAAKFAFGTSLLGFFLSLLFLAMGCENSKVAGLTVSYTGVQGLSHQELSLFSDCNS… |
| A0A4C1TAU0 | 505-789 | None |
| A0A0N4ZK40 | 454-756 | None |
| A0A7F8QTE6 | 18-256 | None |
| A0A182TD88 | 186-416 | None |
| C3ZHR0 | 705-993 | None |
| S4RLL1 | 4-221 | None |
| K7H8R7 | 2-250 | None |
| A0A4W3JHK7 | 263-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.