DPCstruct | MC19911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 253 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3E0Q2 | 1-249 | FRLQTMWAAVVHRYASNNLKIFEDDCTFPNNKRKSERVVKRLHNTVQQPMGTRYPAKRVKITDIKVDFIYDSVQSWLRGMEIMKLTA… |
| A0A6P6JXH1 | 204-480 | MSKSAQNSLLSIFDAISSDSTGPSNEPTVLDVTATLAFDSSTSHLTSTETLKRRFDTSCVVTDVKKRHRSDKQKRQVSEGSESIECR… |
| A0A834CF39 | 417-666 | None |
| A0A3N0XLD0 | 319-561 | None |
| A0A151MM00 | 587-805 | None |
| A0A498M1M3 | 1-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.