DPCstruct | MC1991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 182 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355A5D9 | 235-415 | IYFGERQNTYSIVRTKEKEFDYPAGAGKTMTTTYQGRDGISLRRFLTRILFAAKLQESNLILSGYIKDESRILLHCNIKERVSKLAP… |
| A0A4Q2WIW1 | 143-334 | IYYGESNDGYVFVNTKTKEFDYPQGDGNAYTTYEGDGGIKIGSFVRKAVLSLALTDYKLFLTGDIDKDSQLLLHRNIKERVPKIAPF… |
| A0A358II29 | 6-184 | None |
| A0A2D6D2I4 | 659-862 | None |
| A0A1D3RPL3 | 229-394 | None |
| A0A4D4KB26 | 431-653 | None |
| A0A336P3K8 | 110-293 | None |
| A0A6G3VHD4 | 73-260 | None |
| A0A7C4I562 | 455-625 | None |
| A0A812UG15 | 732-928 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.