DPCstruct | MC19908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3XRA4 | 84-214 | MVNRLFVVSYEIDYVHRVSVGVTADSPKAAQQIAEQAFNDGTIWDDTAAMPLLSDEYHEVEDESLVWESVTVEQLPEPDYSVRQLKK… |
| A0A291IQ78 | 51-193 | EVLTEENPSPAYAVTYTLDYTHRVVVGIVAESADGAQAVAEAAFDDGTIWDDTPEMPLLFDDFEEVDGETLRWQVEAVDVWPKADAS… |
| F2LRM7 | 26-171 | None |
| A0A2S5Q9V9 | 1-126 | None |
| A0A1G0KUK0 | 80-188 | None |
| H8GPN2 | 2-115 | None |
| A0A3M1EG88 | 2-119 | None |
| A0A2S5CII9 | 5-127 | None |
| A0A4R1BDT9 | 4-139 | None |
| A0A658AB53 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.