DPCstruct | MC19907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 14.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.89 |
| Pfam Score | 82.15 |
| Assigned Pfam label(s) | CL0459- CL0306- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287GCI7 | 110-231 | EDMMFYGPLEKCPICGGQLECKGWKYKCTGKYSEWASCIFSSNSPPRKSDPIKVPEDVSNDFLNKWLKQQEGKGYPKRDVDEEAHIF… |
| A0A6N2LKP9 | 1-128 | MVQDVLFFGPLDKCPLCSSNLEFDGKRYSCKGFYSEWSSCTFKTRTPPRKEEPLKLPDSVLNSSVAEFLKKHQDPSRRPCQGAPIKH… |
| W1NGK6 | 9-146 | None |
| A0A452XNX2 | 88-219 | None |
| A0A834FP70 | 228-331 | None |
| A0A452ZI98 | 1-100 | None |
| A0A452ZI88 | 110-231 | None |
| A0A452ZI47 | 2-119 | None |
| A0A084WSM4 | 859-992 | None |
| A0A2P5X8D8 | 104-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.