DPCstruct | MC19904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5AC79 | 2-135 | QSSSQIKGAAGSLKSLQNSNSCAIPRTDEYGASPRISNPAGFKHGKHIGMPNGGIYAAQIQAMNEEVTELKLSVDTLEKERDFYFAK… |
| A0A6N2LI48 | 1-152 | MRTITHRRTKGGRDRNSRGSQKTTKSLQASNVHNSASGYTVDLNKMSGQKQGRGSAVVGEAYSSEEIQALSKEITDMNLSVDLLEKE… |
| A0A6V7P6Y6 | 325-444 | None |
| A0A426YKJ0 | 35-176 | None |
| A0A445G4Q0 | 57-181 | None |
| A0A200QZR9 | 132-261 | None |
| A0A834TYI4 | 23-170 | None |
| A0A078JPR2 | 62-203 | None |
| A0A540NEW7 | 6-151 | None |
| A0A1S2YDF5 | 67-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.