DPCstruct | MC1990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 224 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0NJY2 | 435-659 | STCPPNNLGCTPCTPKKRLKILQPSGYLNNSAVYTLGVLPHPYTLLSLQRGSDNITVRYIRRETDRDRWLIEATKILLGENIDSFTR… |
| A0A0G4NRP1 | 40-260 | MHIGTPARYRNSLTLYTIGTVPHPYTTAVMTQMSTSITVRWIRRESPRDPWLAAATIELLGAAVGGSPRVLYFKEAVGADASTASSL… |
| H0ET61 | 1-223 | None |
| A0A0J9XEN6 | 137-349 | None |
| A0A177ACF6 | 158-391 | None |
| A0A0G4KXE3 | 391-607 | None |
| A0A4S2MX71 | 278-488 | None |
| A0A0N1HRF5 | 238-482 | None |
| M7T5H7 | 100-304 | None |
| A0A1B8CZK9 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.