DPCstruct | MC199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 251 ± 26 aa |
| Standard deviation of domain lengths | 25.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7F5P3 | 13-252 | SVSWSLEAFGRDYSLRIEGQKSMHFEKRLAMHAPIGFYAGSDRREQLRLAINGELYQRVKVEGEIENAGSGDEEGILWLSLKDRAAG… |
| A0A2N5ZH57 | 14-262 | LFLSNLIFADDLMIFGNKTFDVKNIKLDGDITRFVLENPDLSEGTSIDQALKLKVMGDLAPGIKINAVFDDTKVQNDNREITLFMTG… |
| A0A847M904 | 28-285 | None |
| A0A1V5U858 | 25-261 | None |
| A0A1V5V3P9 | 150-428 | None |
| A0A1F7WSK3 | 209-462 | None |
| A0A1Y0H2I0 | 1-303 | None |
| B8CZF5 | 29-245 | None |
| A0A7V3RFJ9 | 12-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.