DPCstruct | MC19899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2LBD0 | 1-131 | MAKTSNIHEQSHKPHRLRQAGPSQKTKKKKQQGGGGEEKKRNPKAFGFSSSVKAKKLQSRTVEKEQRKLHVPTIERNYGEPPPFVVV… |
| A0A1B0DH46 | 1-130 | MEDSGAMEKKKEHRKRKSGVKAEKKKNKGKPKGDEMAERQKNPKAFAINSAQRAERKFRRKEDLTAKKQHIPLVDQTPEEPPPFLIA… |
| A0A1A8KDV3 | 1-128 | None |
| A0A453I5T4 | 35-159 | None |
| A0A8B6BDV8 | 1-150 | None |
| A0A445FEM6 | 127-233 | None |
| A0A438GV46 | 49-181 | None |
| A0A3Q0IST4 | 348-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.