DPCstruct | MC19898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 2 aa |
| Standard deviation of domain lengths | 2.24 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 79.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287UAF5 | 6-91 | CHDIGREQAANRPLLKTIFEVLMRLFSPRKTTLLLVIRDKTKTPVEYLAQALKEDIHKIWDSVPKPEVFKKAALSEFFNVEVTALS |
| A0A0A9CXG3 | 1-80 | MWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLLFVIRDKSRTPLENLEPILREDIQKIWDAVPKPHAHKETSLSEFF |
| A0A6P5TIC3 | 156-241 | None |
| A0A6N2LSH1 | 106-185 | None |
| A0A6A6LJ66 | 134-219 | None |
| A0A287QEH5 | 70-155 | None |
| A0A444EQ60 | 3-88 | None |
| A0A2H5NF64 | 68-153 | None |
| A0A446VH48 | 67-152 | None |
| A0A835D338 | 457-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.