DPCstruct | MC19897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 145 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2L8Y6 | 11-155 | VVAITALIIYVTRVALGYKQTWDRYQLLVNKTLYEKTLASGFGSVHFLLDASEQQQYKEAILAYAILLKDTNGQVTCHRNVGDDCER… |
| A0A849BPJ7 | 2-83 | KETLLAYHFLRTADGPLTADVLDQRIEDWFRRRWETTFDFEIRGGLDKLRELELLTEDEHGALGVVGLPEAKQRLDRRWDNL |
| A0A846D0D3 | 164-331 | None |
| A0A0E0JT61 | 342-485 | None |
| A0A2W4ZKF8 | 465-627 | None |
| A0A438DB12 | 121-268 | None |
| A0A2G3BCM2 | 148-309 | None |
| A0A1D6F5Z4 | 196-297 | None |
| A0A2P6S6S4 | 1-115 | None |
| A0A2I0XDY7 | 113-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.