DPCstruct | MC19895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 139 ± 33 aa |
| Standard deviation of domain lengths | 33.40 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.05 |
| Pfam Score | 99.50 |
| Assigned Pfam label(s) | CL0392- PF10497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3CA59 | 1-98 | CSRCHSATGMFCRACLLIRYGLELEDVREKMAKGEWLCPHCYEEDHPNEGWICNSSICMTRRGMAPTGIAIYEAQGKGFQSVAHFVQ… |
| A0A6N2L3E5 | 30-185 | STPADSNGKEFVEKSRTKCPGVPVVGGRIHDSQNGKNCHQCRQKTLDFAAVCTTQKGNKLCTLKFCHKCLLNRYGEKAEEVALLDNW… |
| A0A1R3JIR8 | 21-145 | None |
| A0A453E0B4 | 1-131 | None |
| A0A164YA76 | 21-131 | None |
| A0A1Q3DCK7 | 85-236 | None |
| A0A194YP87 | 4-124 | None |
| A0A7S2UUV5 | 2-106 | None |
| A0A5N6PWB0 | 112-285 | None |
| A0A6A4JVF3 | 213-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.