DPCstruct | MC19893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5CRF8 | 1-110 | MRLLQLGLLLALTSGFLAILIYITGVTNLYGKVNLSDEDLNALLSLRSDFQKCVRINGLGLQALSGADYCQIKIQFPSDTIPKWKDP… |
| A0A6N2KZM6 | 1-111 | MRLLQLGFFLALASGLSALLIYIAGVSDLYTTTKLSDQDLEALQSLQNGFKKCVSKNGLGLQAVTKGSDYCQVTLNFPTDTVPKWKD… |
| A0A4P1RE52 | 19-124 | None |
| A0A453MXK6 | 26-134 | None |
| M4DQ17 | 1-134 | None |
| A0A2N9IIE9 | 4-119 | None |
| A0A6A1UHT9 | 624-726 | None |
| A0A7J0H2K8 | 1-110 | None |
| A0A6J0KWG7 | 1-98 | None |
| A0A371DZ19 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.